Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2222 |
| Peptide Name | Defensin-1, Antifungal protein Psd1, Defense-related peptide 1 |
| PMID(s) | 10860545, 11812144, 11697857 |
| Plant Source (Scientific Name) | Pisum sativum |
| Plant Source (Common Name) | Garden pea |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antimicrobial, Antifungal |
| Peptide Function Description | Target site: lipid bilayer, Shows antifungal activity and sodium and potassium channel inhibiting activity. |
| Activity Against | Aspergillus niger (IC50: 12.1 µg/ml), Aspergillus niger (IC50: 7.4 µg/ml), Aspergillus versicolor (IC50: <5.0 µg/ml), Aspergillus versicolor (IC50: 6.0 µg/ml), Fusarium moniliforme (IC50: 21.7 µg/ml), Fusarium moniliforme (IC50: 33.2 µg/ml ), Fusarium oxysporum (IC50>100 µg/ml), Fusarium oxysporum (>100 µg/ml), Fusarium solani (12.1 µg/ml), Fusarium solani (79.2 µg/ml), Neurospora crassa (0.04 µg/ml), Neurospora crassa (0.05 µg/ml), Saccharomyces cerevisiae (>100 µg/ml ), Trichophyton mentagrophytes (>100 µg/ml) |
| IC50 value | 12.1 µg/ml | 7.4 µg/ml | <5.0 µg/ml | 6.0 µg/ml | 21.7 µg/ml | 33.2 µg/ml | >100 µg/ml | >100 µg/ml | 12.1 µg/ml | 79.2 µg/ml | 0.04 µg/ml | 0.05 µg/ml | >100 µg/ml | >100 µg/ml |
| Sequence | KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC |
| Sequence Length | 46 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5208.88 |
| Monoisotopic Molecular Weight (Da) | 5205.21 |
| Isoelectric Point (pI) | 7.73 |
| Method / Extraction | NMR |