PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2222	"Defensin-1, Antifungal protein Psd1, Defense-related peptide 1"	"10860545, 11812144, 11697857"	"Pisum sativum"	Fabaceae	Defensin	"Antimicrobial, Antifungal"	"Target site: lipid bilayer, Shows antifungal activity and sodium and potassium channel inhibiting activity."	"Aspergillus niger (IC50: 12.1 µg/ml), Aspergillus niger (IC50: 7.4 µg/ml), Aspergillus versicolor (IC50: <5.0 µg/ml), Aspergillus versicolor (IC50: 6.0 µg/ml), Fusarium moniliforme (IC50: 21.7 µg/ml), Fusarium moniliforme (IC50: 33.2 µg/ml ), Fusarium oxysporum (IC50>100 µg/ml), Fusarium oxysporum (>100 µg/ml), Fusarium solani (12.1 µg/ml), Fusarium solani (79.2 µg/ml), Neurospora crassa (0.04 µg/ml), Neurospora crassa (0.05 µg/ml), Saccharomyces cerevisiae (>100 µg/ml ), Trichophyton mentagrophytes (>100 µg/ml)"	KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC	46	"Experimental evidence at protein level"	5208.88	5205.21	7.73	NMR	"Synthesis Type : Ribosomal, Experimental system used NMR, Also known as Defense-related peptide 1"