Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2217 |
| Peptide Name | Circulin-A, CIRA |
| PMID(s) | 10430870, 27208129, 4288271, 8920961, 9878410 |
| Plant Source (Scientific Name) | Chassalia parvifolia |
| Plant Source (Common Name) | --NA-- |
| Plant Family | Rubiaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Antifungal, Hemolytic, Cytotoxic, Anti-HIV |
| Peptide Function Description | Shows haemolytic activity against Gram-positive bacteria; circulin A shown to possess some anti-bacterial activity; Circulin A shown to possess antiviral cytoprotective activity; Target site: lipid bilayer; 50% Hemolysis against Human erythrocytes at 1020 µM |
| Activity Against | Escherichia coli (MIC: >500 µM), Pseudomonas aeruginosa (MIC: >500 µM), Proteus vulgaris (MIC: 54.6 µM), Proteus vulgaris (MIC: >500 µM), Klebsiella oxytoca (MIC: >500 µM), Staphylococcus aureus (MIC: 0.19 µM), Micrococcus luteus (MIC: >500 µM), Candida albicans (MIC: >500 µM), Candida kefyr (MIC: 18.6 µM), Candida kefyr (MIC: >500 µM), Candida tropicalis (MIC: 19.4 µM), Candida tropicalis (MIC: >500 µM) |
| IC50 value | --NA-- |
| Sequence | GIPCGESCVWIPCISAALGCSCKNKVCYRN |
| Sequence Length | 30 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3175.78 |
| Monoisotopic Molecular Weight (Da) | 3173.44 |
| Isoelectric Point (pI) | 8.33 |
| Method / Extraction | MS, NMR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P58457, B6E619 |
| NCBI | 17433719 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_755, PhytAMP_PHYT00144, EROP-Moscow_03475, Cybase_8, CAMPSQ203, APD_00274 |
|---|
| Addtional Information | These are identified as good candidates for development of natural additives to prevent food spoilage; Synthesis Type : Ribosomal| Blocking the Arg produced no significant effect on activity against S. aureus. The two-disulfide synthetic variant exhibited antimicrobial profiles similar to the native peptide. Shows 95% inhibition against (Lactobacillus brevis L1055: >50 ¼g/ml |Pediococcus dextrinicus DSM 20293: >50 ¼g/ml|Staphylococcus aureus Newman: >50 ¼g/ml|Salmonella typhimurium SL1344: >50 ¼g/ml) |
