PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2217	"Circulin-A, CIRA"	"10430870, 27208129, 4288271, 8920961, 9878410"	"Chassalia parvifolia"	Rubiaceae	Cyclotide	"Antibacterial, Antifungal, Hemolytic, Cytotoxic, Anti-HIV"	"Shows haemolytic activity against Gram-positive bacteria; circulin A shown to possess some anti-bacterial activity; Circulin A shown to possess antiviral cytoprotective activity; Target site: lipid bilayer; 50% Hemolysis against Human erythrocytes at 1020 µM"	"Escherichia coli (MIC: >500 µM), Pseudomonas aeruginosa (MIC: >500 µM), Proteus vulgaris (MIC: 54.6 µM), Proteus vulgaris (MIC: >500 µM), Klebsiella oxytoca (MIC: >500 µM), Staphylococcus aureus (MIC: 0.19 µM), Micrococcus luteus (MIC: >500 µM), Candida albicans (MIC: >500 µM), Candida kefyr (MIC: 18.6 µM), Candida kefyr (MIC: >500 µM), Candida tropicalis (MIC: 19.4 µM), Candida tropicalis (MIC: >500 µM)"	GIPCGESCVWIPCISAALGCSCKNKVCYRN	30	"Experimental evidence at protein level"	3175.78	3173.44	8.33	"MS, NMR"	"These are identified as good candidates for development of natural additives to prevent food spoilage; Synthesis Type : Ribosomal| Blocking the Arg produced no significant effect on activity against S. aureus. The two-disulfide synthetic variant exhibited antimicrobial profiles similar to the native peptide. Shows 95% inhibition against (Lactobacillus brevis L1055: >50 ¼g/ml |Pediococcus dextrinicus DSM 20293: >50 ¼g/ml|Staphylococcus aureus Newman: >50 ¼g/ml|Salmonella typhimurium SL1344: >50 ¼g/ml)"