Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2216 |
| Peptide Name | Cyclopsychotride-A, CPT |
| PMID(s) | 10430870 |
| Plant Source (Scientific Name) | Psychotria longipes |
| Plant Source (Common Name) | --NA-- |
| Plant Family | Rubiaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Antifungal, Hemolytic, Cytotoxic, Neurotensin-inhibitor |
| Peptide Function Description | inhibits the cytopathic effects and replication of the himan immunodeficiency virus; is active against Gram-positive and Gram-negative bacteria; Shows potent hemolytic activity; Compound 1 of cyclopsychotride A inhibited neurotensin binding to HT-29 cell membranes and also stimulated increased levels of cytosolic Ca2 in two unrelated cell lines that do not express neurotensin receptors., Target site: lipid bilayer; 50% Hemolysis against Human erythrocytes at 405 µM; Mouse fibroblasts(IC50: 1850 µM) |
| Activity Against | Escherichia coli (MIC: 1.55 µM), Escherichia coli (MIC: >500 µM), Pseudomonas aeruginosa (MIC: 13.5 µM), Pseudomonas aeruginosa (MIC: 50.2 µM), Proteus vulgaris (MIC: 13.2 µM), Proteus vulgaris (MIC: >500 µM), Klebsiella oxytoca (MIC: 5.80 µM ), Klebsiella oxytoca (MIC: 13.2 µM), Staphylococcus aureus (MIC: 39.0 µM), Staphylococcus aureus (MIC: >500 µM ), Micrococcus luteus (MIC: 48.0 µM), Micrococcus luteus (MIC: >500 µM), Candida albicans (MIC: >500 µM), Candida kefyr (MIC: 14.0 µM), Candida kefyr (MIC: 48.0 µM ), Candida tropicalis (MIC: 56.5 µM), Candida tropicalis (MIC: >500 µM) |
| IC50 value | --NA-- |
| Sequence | SIPCGESCVFIPCTVTALLGCSCKSKVCYKN |
| Sequence Length | 31 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3254.92 |
| Monoisotopic Molecular Weight (Da) | 3252.52 |
| Isoelectric Point (pI) | 8.28 |
| Method / Extraction | Amino acid analysis |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P58457, B6E619 |
| NCBI | 17433720 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_756, PhytAMP_PHYT00150, EROP-Moscow_03499, Cybase_32, CAMPSQ204, APD_00282 |
|---|
| Addtional Information | Synthesis Type : Ribosomal, It is cyclic and contains three disulfide bonds:4,21; 8,23; 13,28. Updated 8/2008. |
