PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2216	"Cyclopsychotride-A, CPT"	10430870	"Psychotria longipes"	Rubiaceae	Cyclotide	"Antibacterial, Antifungal, Hemolytic, Cytotoxic, Neurotensin-inhibitor"	"inhibits the cytopathic effects and replication of the himan immunodeficiency virus; is active against Gram-positive and Gram-negative bacteria; Shows potent hemolytic activity; Compound 1 of cyclopsychotride A inhibited neurotensin binding to HT-29 cell membranes and also stimulated increased levels of cytosolic Ca2 in two unrelated cell lines that do not express neurotensin receptors., Target site: lipid bilayer; 50% Hemolysis against Human erythrocytes at 405 µM; Mouse fibroblasts(IC50: 1850 µM)"	"Escherichia coli (MIC: 1.55 µM), Escherichia coli (MIC: >500 µM), Pseudomonas aeruginosa (MIC: 13.5 µM), Pseudomonas aeruginosa (MIC: 50.2 µM), Proteus vulgaris (MIC: 13.2 µM), Proteus vulgaris (MIC: >500 µM), Klebsiella oxytoca (MIC: 5.80 µM ), Klebsiella oxytoca (MIC: 13.2 µM), Staphylococcus aureus (MIC: 39.0 µM), Staphylococcus aureus (MIC: >500 µM ), Micrococcus luteus (MIC: 48.0 µM), Micrococcus luteus (MIC: >500 µM), Candida albicans (MIC: >500 µM), Candida kefyr (MIC: 14.0 µM), Candida kefyr (MIC: 48.0 µM ), Candida tropicalis (MIC: 56.5 µM), Candida tropicalis (MIC: >500 µM)"	SIPCGESCVFIPCTVTALLGCSCKSKVCYKN	31	"Experimental evidence at protein level"	3254.92	3252.52	8.28	"Amino acid analysis"	"Synthesis Type : Ribosomal, It is cyclic and contains three disulfide bonds:4,21; 8,23; 13,28. Updated 8/2008. "