Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2204 |
| Peptide Name | Cp-thionin-2, Defensin-like protein 2 |
| PMID(s) | 16824043, 27208129 |
| Plant Source (Scientific Name) | Vigna unguiculata |
| Plant Source (Common Name) | cowpea |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial |
| Peptide Function Description | possesses antibacterial activity against the Gram-positive bacterium Staphylococcus aureus and the Gram-negative bacteria Escherichia coli and Pseudomonas syringae, Target site: lipid bilayer , These are identified as good candidates for development of natural additives to prevent food spoilage. |
| Activity Against | Staphylococcus aureus (MIC: 128 µg/ml), Escherichia coli (MIC: 64 µg/ml), Pseudomonas syringae (MIC: 42 µg/ml), Ralstonia solanAngiotensin Converting Enzymearum, Rhataybacter sp., Erwinia sp. |
| IC50 value | --NA-- |
| Sequence | KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC |
| Sequence Length | 46 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5242.24 |
| Monoisotopic Molecular Weight (Da) | 5238.4 |
| Isoelectric Point (pI) | 9.2 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P84920 |
| NCBI | 114152286 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_1964, PhytAMP_PHYT00006, EROP-Moscow_05833, CAMPSQ945, APD_01356 |
|---|
| Addtional Information | Synthesis Type : Ribosomal| shows 95% inhibition against(Lactobacillus brevis L1055: 12.7 ¼g/ml|Pediococcus dextrinicus DSM 20293: 10.7 ¼g/ml|Staphylococcus aureus Newman: >40 ¼g/ml|Bacillus cereus NCIMB 1526: >40 ¼g/ml|Salmonella typhimurium SL1344: >40 ¼g/ml|Escherichia coli MG1655: >40 ¼g/ml|Pseudomonas aeruginosa NCIMB 950: 21.4 ¼g/ml), It showed activity against human pathogens such as E. coli, S. aureus, and P. syringae. In silico prediction as beta-structure similar to other defensins. As many as 4 S-S bonds are possible. A linear analog, KT43C, is active against F. culmorum, P. expansum and A. niger. It appears to damage membranes and induce reactive oxygen species (Food Microbi 2018). This study suggests that disulfide bonds are not absoultely needed for activity. 3/2018. |
