PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2204	"Cp-thionin-2, Defensin-like protein 2"	"16824043, 27208129"	"Vigna unguiculata"	Fabaceae	Defensin	Antibacterial	"possesses antibacterial activity against the Gram-positive bacterium Staphylococcus aureus and the Gram-negative bacteria Escherichia coli and Pseudomonas syringae, Target site: lipid bilayer , These are identified as good candidates for development of natural additives to prevent food spoilage."	"Staphylococcus aureus (MIC: 128 µg/ml), Escherichia coli (MIC: 64 µg/ml), Pseudomonas syringae (MIC: 42 µg/ml), Ralstonia solanAngiotensin Converting Enzymearum, Rhataybacter sp., Erwinia sp."	KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC	46	"Experimental evidence at protein level"	5242.24	5238.4	9.2	--NA--	"Synthesis Type : Ribosomal| shows 95% inhibition against(Lactobacillus brevis L1055: 12.7 ¼g/ml|Pediococcus dextrinicus DSM 20293: 10.7 ¼g/ml|Staphylococcus aureus Newman: >40 ¼g/ml|Bacillus cereus NCIMB 1526: >40 ¼g/ml|Salmonella typhimurium SL1344: >40 ¼g/ml|Escherichia coli MG1655: >40 ¼g/ml|Pseudomonas aeruginosa NCIMB 950: 21.4 ¼g/ml), It showed activity against human pathogens such as E. coli, S. aureus, and P. syringae. In silico prediction as beta-structure similar to other defensins. As many as 4 S-S bonds are possible. A linear analog, KT43C, is active against F. culmorum, P. expansum and A. niger. It appears to damage membranes and induce reactive oxygen species (Food Microbi 2018). This study suggests that disulfide bonds are not absoultely needed for activity. 3/2018."