Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2199 |
| Peptide Name | Defensin AtPDF2.3 |
| PMID(s) | 10617197, 11437247, 14593172, 27573545, 9001391 |
| Plant Source (Scientific Name) | Arabidopsis thaliana, Arabidopsis lyrata |
| Plant Source (Common Name) | Mouse-ear cress, Lyre-leaved rock-cress |
| Plant Family | Brassicaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal, Antimicrobial |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Botrytis cinerea (IC50: 5.8 ±0.0 µM), Botrytis cinerea (IC50: 5.8 ±0.0 µM), Fusarium oxysporum (IC50: 4.4 ±1.6 µM), Fusarium culmorum (IC50: 1.0 ±0.4 µM), Verticillium dahliae (IC50: 4.4 ±1.6 µM), Fusarium graminearum (IC50: 1.4 ±0.0 µM), Saccharomyces cerevisiae (IC50: 8.1 ±0.9 µM), Saccharomyces cerevisiae (IC50: 3.3 ±0.0 µM) |
| IC50 value | 5.8 ±0.0 µM | 5.8 ±0.0 µM | 4.4 ±1.6 µM | 1.0 ±0.4 µM | 4.4 ±1.6 µM | 1.4 ±0.0 µM | 8.1 ±0.9 µM | 3.3 ±0.0 µM |
| Sequence | RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC |
| Sequence Length | 47 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5348.1 |
| Monoisotopic Molecular Weight (Da) | 5344.39 |
| Isoelectric Point (pI) | 9.49 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | D7LQ02, Q9ZUL7, A0A178VXG1 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_9596, PhytAMP_PHYT00036, EROP-Moscow_03982, CAMPSQ4493, APD_02736 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; APD analysis reveals that the sequence of THE PEPTIDE shows 74.5% similarity to plant defensin MtDef4. Active against S. cerevisiae. Note that antifungal activity is not correlated with channel blocking property of the peptide. |
