PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2199	"Defensin AtPDF2.3"	"10617197, 11437247, 14593172, 27573545, 9001391"	"Arabidopsis thaliana, Arabidopsis lyrata"	Brassicaceae	Defensin	"Antifungal, Antimicrobial"	"Target site- Lipid Bilayer"	"Botrytis cinerea (IC50: 5.8 ±0.0 µM), Botrytis cinerea (IC50: 5.8 ±0.0 µM), Fusarium oxysporum (IC50: 4.4 ±1.6 µM), Fusarium culmorum (IC50: 1.0 ±0.4 µM), Verticillium dahliae (IC50: 4.4 ±1.6 µM), Fusarium graminearum (IC50: 1.4 ±0.0 µM), Saccharomyces cerevisiae (IC50: 8.1 ±0.9 µM), Saccharomyces cerevisiae (IC50: 3.3 ±0.0 µM)"	RTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC	47	"Experimental evidence at protein level"	5348.1	5344.39	9.49	--NA--	"Synthesis Type: Ribosomal; APD analysis reveals that the sequence of THE PEPTIDE shows 74.5% similarity to plant defensin MtDef4. Active against S. cerevisiae. Note that antifungal activity is not correlated with channel blocking property of the peptide. "