Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_2187
Peptide Name	MiAMP1
PMID(s)	10543955, 9108242
Plant Source (Scientific Name)	Macadamia integrifolia
Plant Source (Common Name)	Macadamia nut
Plant Family	Proteaceae
Peptide Family	Beta-Barrelin, Defensin
Peptide Function	Antibacterial, Antifungal, Antiyeast
Peptide Function Description	Target site- Lipid Bilayer
Activity Against	Alternaria helianthi (IC50: 2-5 µg/ml), Alternaria helianthi (IC50: >100 µg/ml), Botrytis cinerea (IC50: 5-10 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Ceratocystis paradoxa (IC50: 20 µg/ml), Ceratocystis paradoxa (IC50: 75 µg/ml), Colletotrichum falcatum (IC50: >100 µg/ml), Colletotrichum gloeosporioides (IC50: 2-5 µg/ml), Colletotrichum gloeosporioides (IC50: >100 µg/ml), Fusarium oxysporum (IC50: 2-5 µg/ml), Fusarium oxysporum (IC50: 100 µg/ml), Leptosphaeria maculans (IC50: 5 µg/ml), Leptosphaeria maculans (IC50: >50 µg/ml), Macrophomina phaseolina (IC50: <25 µg/ml), Macrophomina phaseolina (IC50: >100 µg/ml), Phytophthora cryptogea IC50 5-10 µg/ml), Phytophthora cryptogea (IC50: >100 µg/ml), Pythium graminicola (IC50: 5 µg/ml), Pythium graminicola (IC50: >100 µg/ml), Sclerotinia sclerotiorum (IC50: 5 µg/ml), Sclerotinia sclerotiorum (IC50: >100 µg/ml), Sclerotinia sclerotiorum (IC50: 50 µg/ml), Sclerotinia sclerotiorum (IC50: >100 µg/ml), Sclerotium rolfsii (IC50: >100 µg/ml), Verticillium dahliae (IC50: 2 µg/ml), Verticillium dahliae (IC50: >100 µg/ml), Clavibacter michiganensis (IC50: <10 µg/ml), Pseudomonas rubrilineans (IC50: >100 µg/ml), Aspergillus fumigatus (IC50: >100 µg/ml), Candida albicans (IC50: >100 µg/ml), Microsporum gypseum (IC50: >100 µg/ml), Escherichia coli (IC50: >100 µg/ml), Saccharomyces cerevisiae (IC50: 2-5 µg/ml)
IC50 value	2-5 µg/ml | >100 µg/ml | 5-10 µg/ml | >100 µg/ml | 20 µg/ml | 75 µg/ml | >100 µg/ml | 2-5 µg/ml | >100 µg/ml | 2-5 µg/ml | 100 µg/ml | 5 µg/ml | >50 µg/ml | <25 µg/ml | >100 µg/ml | 5-10 µg/ml | >100 µg/ml | 5 µg/ml | >100 µg/ml | 5 µg/ml | >100 µg/ml | 50 µg/ml | >100 µg/ml | >100 µg/ml | 2 µg/ml | >100 µg/ml | <10 µg/ml | >100 µg/ml | >100 µg/ml | >100 µg/ml | >100 µg/ml | >100 µg/ml | 2-5 µg/ml
Sequence	SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC
Sequence Length	76
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	8138.05
Monoisotopic Molecular Weight (Da)	8132.71
Isoelectric Point (pI)	9.08
Method / Extraction	NMR

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_2187

External links (Uniprot, PDB and Source Information Database)
Uniprot	P80915, O04396
NCBI	3121752
EMBL	--NA--
Link to Source Databases	DBAASP_2016, PhytAMP_PHYT00269, CAMPSQ960, APD_00428
Addtional Information	Synthesis Type : Ribosomal; It contains three disulfide bonds: 1,64; 21,76;23,49. Miamp1, a Novel Protein from Macadamia Integrifolia Adopts a Greek Key Beta- Barrel Fold Unique Amongst Plant Antimicrobial Proteins (J.Mol.Biol. 1999; 293: 62). You can rotate, zoom, and view the 3D structure here in the PDB . Updarted 8/2012; 2/2014; 8/2015.