PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2187	MiAMP1	"10543955, 9108242"	"Macadamia integrifolia"	Proteaceae	"Beta-Barrelin, Defensin"	"Antibacterial, Antifungal, Antiyeast"	"Target site- Lipid Bilayer"	"Alternaria helianthi (IC50: 2-5 µg/ml), Alternaria helianthi (IC50: >100 µg/ml), Botrytis cinerea (IC50: 5-10 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Ceratocystis paradoxa (IC50: 20 µg/ml), Ceratocystis paradoxa (IC50: 75 µg/ml), Colletotrichum falcatum (IC50: >100 µg/ml), Colletotrichum gloeosporioides (IC50: 2-5 µg/ml), Colletotrichum gloeosporioides (IC50: >100 µg/ml), Fusarium oxysporum (IC50: 2-5 µg/ml), Fusarium oxysporum (IC50: 100 µg/ml), Leptosphaeria maculans (IC50: 5 µg/ml), Leptosphaeria maculans (IC50: >50 µg/ml), Macrophomina phaseolina (IC50: <25 µg/ml), Macrophomina phaseolina (IC50: >100 µg/ml), Phytophthora cryptogea IC50 5-10 µg/ml), Phytophthora cryptogea (IC50: >100 µg/ml), Pythium graminicola (IC50: 5 µg/ml), Pythium graminicola (IC50: >100 µg/ml), Sclerotinia sclerotiorum (IC50: 5 µg/ml), Sclerotinia sclerotiorum (IC50: >100 µg/ml), Sclerotinia sclerotiorum (IC50: 50 µg/ml), Sclerotinia sclerotiorum (IC50: >100 µg/ml), Sclerotium rolfsii (IC50: >100 µg/ml), Verticillium dahliae (IC50: 2 µg/ml), Verticillium dahliae (IC50: >100 µg/ml), Clavibacter michiganensis (IC50: <10 µg/ml), Pseudomonas rubrilineans (IC50: >100 µg/ml), Aspergillus fumigatus (IC50: >100 µg/ml), Candida albicans (IC50: >100 µg/ml), Microsporum gypseum (IC50: >100 µg/ml), Escherichia coli (IC50: >100 µg/ml), Saccharomyces cerevisiae (IC50: 2-5 µg/ml)"	SAFTVWSGPGCNNRAERYSKCGCSAIHQKGGYDFSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC	76	"Experimental evidence at protein level"	8138.05	8132.71	9.08	NMR	"Synthesis Type : Ribosomal; It contains three disulfide bonds: 1,64; 21,76;23,49. Miamp1, a Novel Protein from Macadamia Integrifolia Adopts a Greek Key Beta- Barrel Fold Unique Amongst Plant Antimicrobial Proteins (J.Mol.Biol. 1999; 293: 62). You can rotate, zoom, and view the 3D structure here in the PDB . Updarted 8/2012; 2/2014; 8/2015."