Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2186 |
| Peptide Name | MsDef1 (defensin 1.3) |
| PMID(s) | 15299136, 21533249, 11101813, 16021402 |
| Plant Source (Scientific Name) | Medicago sativa |
| Plant Source (Common Name) | Alfalfa |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Fusarium graminearum, Neurospora crassa, Fusarium graminearum |
| IC50 value | --NA-- |
| Sequence | RTCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRCWCTKRC |
| Sequence Length | 45 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5194.85 |
| Monoisotopic Molecular Weight (Da) | 5191.24 |
| Isoelectric Point (pI) | 8.51 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q4G3V1, Q9FPM3 |
| NCBI | 75262792 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_9210, PhytAMP_PHYT00047, CAMPSQ1652, APD_00978 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; Inhibits the growth of a filamentous fungus, F. graminearum, A. solani. and F. culmorum at micromolar concentrations. A null mutation of the FgGCS1 gene encoding glucosylceramide synthase in fungi results in a mutant lacking glucosylceramide. The DeltaFggcs1-null mutant becomes resistant to MsDef1, suggesting that the peptide binds to glucosylceramide for toxicity against fungi (Mol Microbiol. 2007 Nov;66(3):771-86). Transgenic plants: expression of this peptide in patato improves resistance to pathogens (Gao AG et al., 2000; Abdallah NA et al., 2010). The C-terminal residues 31-45 contain the major antifungal determinants. MOA: MsDef1 blocks a mammalian L-type calcium (Ca2) channel (Spelbrink RG et al., 2004). Updated 5/2014; 7/2015. | Arg38 |
