PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2186	"MsDef1 (defensin 1.3)"	"15299136, 21533249, 11101813, 16021402"	"Medicago sativa"	Fabaceae	Defensin	Antifungal	"Target site- Lipid Bilayer"	"Fusarium graminearum, Neurospora crassa, Fusarium graminearum"	RTCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRCWCTKRC	45	"Experimental evidence at protein level"	5194.85	5191.24	8.51	--NA--	"Synthesis Type: Ribosomal; Inhibits the growth of a filamentous fungus, F. graminearum, A. solani. and F. culmorum at micromolar concentrations. A null mutation of the FgGCS1 gene encoding glucosylceramide synthase in fungi results in a mutant lacking glucosylceramide. The DeltaFggcs1-null mutant becomes resistant to MsDef1, suggesting that the peptide binds to glucosylceramide for toxicity against fungi (Mol Microbiol. 2007 Nov;66(3):771-86). Transgenic plants: expression of this peptide in patato improves resistance to pathogens (Gao AG et al., 2000; Abdallah NA et al., 2010). The C-terminal residues 31-45 contain the major antifungal determinants. MOA: MsDef1 blocks a mammalian L-type calcium (Ca2) channel (Spelbrink RG et al., 2004). Updated 5/2014; 7/2015. | Arg38"