Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2165 |
| Peptide Name | Vitri F, Cycloviolacin-O19 |
| PMID(s) | 26399495, 20580656, 20580652 |
| Plant Source (Scientific Name) | Viola tricolor |
| Plant Source (Common Name) | heartsease |
| Plant Family | Violaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Anticancer, Cytotoxic, Enzymatic-degradation, Antimicrobial |
| Peptide Function Description | possesses cancer cell toxicity,Shown to possess enzymatic degradation and highly cytotoxic activity against cancer cell lines, Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 10 µM |
| Activity Against | Human glioblastoma U251-MG (IC50: 6.31 µg/ml), Human breast adenocarcinoma MDA-MB-231 (IC50: 2.74 µg/ml), Human lung carcinoma A549 (IC50: 3.58 µg/ml), Human prostate cancer DU145 (IC50: 3.44 µg/ml), Human hepatocarcinoma BEL-7402 (IC50: 5.36 µg/ml) |
| IC50 value | 6.31 µg/ml | 2.74 µg/ml | 3.58 µg/ml | 3.44 µg/ml | 5.36 µg/ml |
| Sequence | GTLPCGESCVWIPCISSVVGCACKSKVCYKD |
| Sequence Length | 31 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3236.86 |
| Monoisotopic Molecular Weight (Da) | 3234.47 |
| Isoelectric Point (pI) | 7.76 |
| Method / Extraction | MS |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_2497, EROP-Moscow_10305, Cybase_605 |
|---|
| Addtional Information | Synthesis Type : Ribosomal |
