PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2165	"Vitri F, Cycloviolacin-O19"	"26399495, 20580656, 20580652"	"Viola tricolor"	Violaceae	Cyclotide	"Anticancer, Cytotoxic, Enzymatic-degradation, Antimicrobial"	"possesses cancer cell toxicity,Shown to possess enzymatic degradation and highly cytotoxic activity against cancer cell lines, Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 10 µM"	"Human glioblastoma U251-MG (IC50: 6.31 µg/ml), Human breast adenocarcinoma MDA-MB-231 (IC50: 2.74 µg/ml), Human lung carcinoma A549 (IC50: 3.58 µg/ml), Human prostate cancer DU145 (IC50: 3.44 µg/ml), Human hepatocarcinoma BEL-7402 (IC50: 5.36 µg/ml)"	GTLPCGESCVWIPCISSVVGCACKSKVCYKD	31	"Experimental evidence at protein level"	3236.86	3234.47	7.76	MS	"Synthesis Type : Ribosomal"