Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2147 |
| Peptide Name | EcAMP1 |
| PMID(s) | 21561864, 24275143 |
| Plant Source (Scientific Name) | Echinochloa crus-galli |
| Plant Source (Common Name) | Cockspur grass |
| Plant Family | Poaceae |
| Peptide Family | Hairpin-like peptide |
| Peptide Function | Antifungal, Anti-protist, Antimicrobial |
| Peptide Function Description | Target site: lipid bilayer |
| Activity Against | Alternaria alternata (EC50: 16.0 ±2.3 µM), Alternaria solani (EC50: 14.0 ±2.1 µM), Aspergillus niger (EC50: >32 µM), Bipolaris sorokiniana (EC50: 18.2 ±2.7 µM), Colletotrichum graminicola (EC50: >10 µM), Diplodia maydis (EC50: >10 µM), Fusarium graminearum (EC50: 4.5 ±1.4 µM), Fusarium oxysporum (EC50: 8.5 ±1.6 µM), Fusarium solani (EC50: 4.0 ±1.2 µM), Fusarium verticillioides (EC50: 8.1 ±2.3 µM), Phoma betae (EC50: 6.0 ±1.5 µM), Phytophthora infestans (EC50: 16.3 ±2.5 µM), Pythium debaryanum (EC50: 12.0 ±1.7 µM), Pythium ultimum (EC50: 14.4 ±2.1 µM), Trichoderma album (EC50: >32 µM), Pseudomonas syringae (MIC: 24.0 µM), Clavibacter michiganensis subsp. michiganensis (MIC: 24.0 µM), Erwinia carotovora subsp. carotovora (MIC: 11.9 µM), Fusarium graminearum (IC50: 4.5 µM), Fusarium oxysporum (IC50: 8.5 µM), Aspergillus niger (IC50: >32.0 µM), Bipolaris sorokiniana (IC50: 18.2 µM) |
| IC50 value | 4.5 µM | 8.5 µM | >32.0 µM | 18.2 µM |
| Sequence | GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD |
| Sequence Length | 37 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 4278.73 |
| Monoisotopic Molecular Weight (Da) | 4275.94 |
| Isoelectric Point (pI) | 9.47 |
| Method / Extraction | NMR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P86698, V5TB87, V5TAQ7, V5TA00, V5T9K0, V5TB82, V5T9J5, B3EWR6 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_4291, EROP-Moscow_11393, CAMPSQ3483, APD_01760 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; There are two disulfide bonds (C7-C29 and C11-C25) that tie the two helices together into a unique beta hairpin structure. Other more sophisticated disulfide bond stabilized helical structures include distinctin and several saposin-like AMPs such as porcine NK-lysin and caenopore-5. MOA: EcAMP1 binds to fungal surface followed by internalization without disrupting membranes. You can rotate, zoom, and view the 3D structure here in the PDB. Updated 9/19/11. GW |
