PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2147	EcAMP1	"21561864, 24275143"	"Echinochloa crus-galli"	Poaceae	"Hairpin-like peptide"	"Antifungal, Anti-protist, Antimicrobial"	"Target site: lipid bilayer"	"Alternaria alternata (EC50: 16.0 ±2.3 µM), Alternaria solani (EC50: 14.0 ±2.1 µM), Aspergillus niger (EC50: >32 µM), Bipolaris sorokiniana (EC50: 18.2 ±2.7 µM), Colletotrichum graminicola (EC50: >10 µM), Diplodia maydis (EC50: >10 µM), Fusarium graminearum (EC50: 4.5 ±1.4 µM), Fusarium oxysporum (EC50: 8.5 ±1.6 µM), Fusarium solani (EC50: 4.0 ±1.2 µM), Fusarium verticillioides (EC50: 8.1 ±2.3 µM), Phoma betae (EC50: 6.0 ±1.5 µM), Phytophthora infestans (EC50: 16.3 ±2.5 µM), Pythium debaryanum (EC50: 12.0 ±1.7 µM), Pythium ultimum (EC50: 14.4 ±2.1 µM), Trichoderma album (EC50: >32 µM), Pseudomonas syringae (MIC: 24.0 µM), Clavibacter michiganensis subsp. michiganensis (MIC: 24.0 µM), Erwinia carotovora subsp. carotovora (MIC: 11.9 µM), Fusarium graminearum (IC50: 4.5 µM), Fusarium oxysporum (IC50: 8.5 µM), Aspergillus niger (IC50: >32.0 µM), Bipolaris sorokiniana (IC50: 18.2 µM)"	GSGRGSCRSQCMRRHEDEPWRVQECVSQCRRRRGGGD	37	"Experimental evidence at protein level"	4278.73	4275.94	9.47	NMR	"Synthesis Type : Ribosomal; There are two disulfide bonds (C7-C29 and C11-C25) that tie the two helices together into a unique beta hairpin structure. Other more sophisticated disulfide bond stabilized helical structures include distinctin and several saposin-like AMPs such as porcine NK-lysin and caenopore-5. MOA: EcAMP1 binds to fungal surface followed by internalization without disrupting membranes. You can rotate, zoom, and view the 3D structure here in the PDB. Updated 9/19/11. GW"