Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_2144
Peptide Name	Antimicrobial peptide 1a, WAMP-1a
PMID(s)	19583772
Plant Source (Scientific Name)	Triticum kiharae, Triticum aestivum, Aegilops tauschii
Plant Source (Common Name)	Wheat, Tausch's goatgrass
Plant Family	Poaceae
Peptide Family	Hevein
Peptide Function	Antibacterial, Antifungal
Peptide Function Description	Target site- Lipid Bilayer
Activity Against	Bipolaris sorokiniana(IC50: 5 µg/ml), Botrytis cinerea (IC50: 20 µg/ml), Fusarium oxysporum (IC50: 5 µg/ml), Fusarium solani (IC50: 5 µg/ml), Fusarium verticillioides (IC50: 30 µg/ml), Neurospora crassa (IC50: 10 µg/ml)
IC50 value	5 µg/ml | 20 µg/ml | 5 µg/ml | 5 µg/ml | 30 µg/ml | 10 µg/ml
Sequence	AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Sequence Length	44
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	4445.02
Monoisotopic Molecular Weight (Da)	4441.73
Isoelectric Point (pI)	8.41
Method / Extraction	NMR

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_2144

External links (Uniprot, PDB and Source Information Database)
Uniprot	P85966, H6S4F8, H6S4F7, H6S4F1
NCBI	263406454
EMBL	--NA--
Link to Source Databases	DBAASP_5256, EROP-Moscow_09066, CAMPSQ1145, APD_01469
Addtional Information	Synthesis Type: Ribosomal; Also active against Clavibacter michiganense, Pseudomonas syringae, Erwinia carotovora, Phytophthora infestans; Assays of recombinant WAMP-1a activity showed that the peptide possessed high broad-spectrum inhibitory activity against diverse chitin-containing and chitin-free pathogens, with IC(50) values in the micromolar range. Structure was solved in water (visit the PDB link). You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014.