PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2144	"Antimicrobial peptide 1a, WAMP-1a"	19583772	"Triticum kiharae, Triticum aestivum, Aegilops tauschii"	Poaceae	Hevein	"Antibacterial, Antifungal"	"Target site- Lipid Bilayer"	"Bipolaris sorokiniana(IC50: 5 µg/ml), Botrytis cinerea (IC50: 20 µg/ml), Fusarium oxysporum (IC50: 5 µg/ml), Fusarium solani (IC50: 5 µg/ml), Fusarium verticillioides (IC50: 30 µg/ml), Neurospora crassa (IC50: 10 µg/ml)"	AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC	44	"Experimental evidence at protein level"	4445.02	4441.73	8.41	NMR	"Synthesis Type: Ribosomal; Also active against Clavibacter michiganense, Pseudomonas syringae, Erwinia carotovora, Phytophthora infestans; Assays of recombinant WAMP-1a activity showed that the peptide possessed high broad-spectrum inhibitory activity against diverse chitin-containing and chitin-free pathogens, with IC(50) values in the micromolar range. Structure was solved in water (visit the PDB link). You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014."