Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2137 |
| Peptide Name | Defensin-like protein 1 / SI alpha-1 |
| PMID(s) | 7705336, 7628617 |
| Plant Source (Scientific Name) | Sorghum bicolor |
| Plant Source (Common Name) | Sorghum |
| Plant Family | Poaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal, Enzyme-inhibitor |
| Peptide Function Description | Target site: lipid bilayer; inhibits strongly the alpha-amylases from the guts of locust and cockroach. |
| Activity Against | Botrytis cinerea (IC50: 100 µg/ml), Botrytis cinerea (IC50: >200 µg/ml), Cladosporium sphaerospermum (IC50: 80 µg/ml), Cladosporium sphaerospermum (IC50: >200 µg/ml), Fusarium culmorum (IC50: >200 µg/ml), Fusarium culmorum (IC50: >200 µg/ml), Penicillium digitatum (IC50: >200 µg/ml), Trichoderma viride (IC50: 50 µg/ml)Trichoderma viride (IC50: >200 µg/ml) |
| IC50 value | 100 µg/ml | >200 µg/ml | 80 µg/ml | >200 µg/ml | >200 µg/ml | >200 µg/ml | >200 µg/ml | 50 µg/ml | >200 µg/ml |
| Sequence | RVCMGKSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC |
| Sequence Length | 47 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5382.2 |
| Monoisotopic Molecular Weight (Da) | 5378.36 |
| Isoelectric Point (pI) | 8.51 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P21923, C5YIJ6 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_1925, EROP-Moscow_08743 |
|---|
| Addtional Information | Synthesis Type : Ribosomal|Protease inhibitor |
