PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2137	"Defensin-like protein 1 / SI alpha-1"	"7705336, 7628617"	"Sorghum bicolor"	Poaceae	Defensin	"Antifungal, Enzyme-inhibitor"	"Target site: lipid bilayer; inhibits strongly the alpha-amylases from the guts of locust and cockroach."	"Botrytis cinerea (IC50: 100 µg/ml), Botrytis cinerea (IC50: >200 µg/ml), Cladosporium sphaerospermum (IC50: 80 µg/ml), Cladosporium sphaerospermum (IC50: >200 µg/ml), Fusarium culmorum (IC50: >200 µg/ml), Fusarium culmorum (IC50: >200 µg/ml), Penicillium digitatum (IC50: >200 µg/ml), Trichoderma viride (IC50: 50 µg/ml)Trichoderma viride (IC50: >200 µg/ml)"	RVCMGKSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC	47	"Experimental evidence at protein level"	5382.2	5378.36	8.51	--NA--	"Synthesis Type : Ribosomal|Protease inhibitor"