Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2123 |
| Peptide Name | Hedyotide B1 |
| PMID(s) | 21979955, 21776968 |
| Plant Source (Scientific Name) | Leptopetalum biflorum, Hedyotis biflora |
| Plant Source (Common Name) | Damanpapra |
| Plant Family | Rubiaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antimicrobial, Enzymatic-degradation |
| Peptide Function Description | Target site- Lipid Bilayer; Shown to possess antimicrobial and enzymatic degradation activity. |
| Activity Against | Staphylococcus aureus (MIC: >80 µM), Staphylococcus epidermidis (MIC: >80 µM), Escherichia coli (MIC: 3.4 µM), Streptococcus salivarius (MIC: 5.9 µM) |
| IC50 value | --NA-- |
| Sequence | GTRCGETCFVLPCWSAKFGCYCQKGFCYRN |
| Sequence Length | 30 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 3429 |
| Monoisotopic Molecular Weight (Da) | 3426.47 |
| Isoelectric Point (pI) | 8.66 |
| Method / Extraction | MS, PcR |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | G9I0X2 |
| NCBI | 365824243 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_4696, Cybase_613, CAMPSQ3621, APD_01916 |
| Addtional Information | Synthesis Type: Ribosomal; Hedyotide B1 is active against E. coli and S. salivarius. However, hedyotide B2 was found to be inactive against the bacteria tested under the conditions. Its exact functional roles remain to be elucidated. The authors suggested the name "uncyclotides" in this article for uncyclized cyclotides. |