PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2123	"Hedyotide B1"	"21979955, 21776968"	"Leptopetalum biflorum, Hedyotis biflora"	Rubiaceae	Cyclotide	"Antimicrobial, Enzymatic-degradation"	"Target site- Lipid Bilayer; Shown to possess antimicrobial and enzymatic degradation activity."	"Staphylococcus aureus (MIC: >80 µM), Staphylococcus epidermidis (MIC: >80 µM), Escherichia coli (MIC: 3.4 µM), Streptococcus salivarius (MIC: 5.9 µM)"	GTRCGETCFVLPCWSAKFGCYCQKGFCYRN	30	"Experimental evidence at transcript level"	3429	3426.47	8.66	"MS, PcR"	"Synthesis Type: Ribosomal; Hedyotide B1 is active against E. coli and S. salivarius. However, hedyotide B2 was found to be inactive against the bacteria tested under the conditions. Its exact functional roles remain to be elucidated. The authors suggested the name ""uncyclotides"" in this article for uncyclized cyclotides. "