Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2114 |
| Peptide Name | cliotide T2 |
| PMID(s) | 21596752, 23419988, 25815333 |
| Plant Source (Scientific Name) | Clitoria ternatea |
| Plant Source (Common Name) | Asian pigeonwings |
| Plant Family | Fabaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Anticancer, Cytotoxic |
| Peptide Function Description | Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at >100 µM; Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization |
| Activity Against | Staphylococcus aureus (MIC: >100 µM), Enterococcus faecalis (MIC: >100 µM), Escherichia coli (MIC: >100 µM), Pseudomonas aeruginosa (MIC: >100 µM), Klebsiella pneumoniae (MIC: >100 µM), Human cervical carcinoma HeLa (IC50: 8.0 µM), Human lung carcinoma A549 (IC50: 7.59 µM), Human lung carcinoma A549/paclitaxel (IC50: 7.92 µM) |
| IC50 value | 8.0 µM | 7.59 µM | 7.92 µM |
| Sequence | GEFLKCGESCVQGECYTPGCSCDWPICKKN |
| Sequence Length | 30 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3285.76 |
| Monoisotopic Molecular Weight (Da) | 3283.36 |
| Isoelectric Point (pI) | 4.87 |
| Method / Extraction | NGS, MS, PcR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | G1CWH1 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_4275, Cybase_765, APD_01775 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; Observed PTMs: oxidation W24, de-amidation Q12 & N30. (Serra et al., 2016) Highly expressed in C. ternatea shoot, flower and pod. (Gilding et al., 2016); Heat stable. Will cyclotides share similar physiological functions of Albumine-1? Updated 11/25/2013. |
