PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2114	"cliotide T2"	"21596752, 23419988, 25815333"	"Clitoria ternatea"	Fabaceae	Cyclotide	"Antibacterial, Anticancer, Cytotoxic"	"Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at >100 µM; Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization"	"Staphylococcus aureus (MIC: >100 µM), Enterococcus faecalis (MIC: >100 µM), Escherichia coli (MIC: >100 µM), Pseudomonas aeruginosa (MIC: >100 µM), Klebsiella pneumoniae (MIC: >100 µM), Human cervical carcinoma HeLa (IC50: 8.0 µM), Human lung carcinoma A549 (IC50: 7.59 µM), Human lung carcinoma A549/paclitaxel (IC50: 7.92 µM)"	GEFLKCGESCVQGECYTPGCSCDWPICKKN	30	"Experimental evidence at protein level"	3285.76	3283.36	4.87	"NGS, MS, PcR"	"Synthesis Type : Ribosomal; Observed PTMs: oxidation W24, de-amidation Q12 & N30. (Serra et al., 2016) Highly expressed in C. ternatea shoot, flower and pod. (Gilding et al., 2016); Heat stable. Will cyclotides share similar physiological functions of Albumine-1? Updated 11/25/2013."