Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2097 |
| Peptide Name | Cyclotide cter-R, Cyclotide cliotide T7 |
| PMID(s) | 23419988, 27007913, 28669767 |
| Plant Source (Scientific Name) | Clitoria ternatea |
| Plant Source (Common Name) | Asian pigeonwings |
| Plant Family | Fabaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Anticancer, Antifungal |
| Peptide Function Description | Target site: lipid bilayer ; Cationic cliotides display potent antibacterial activity against Gram-negative bacteria. It also possess prominent immunostimulating activity. Cationic cliotides are capable of secretion of various cytokines and chemokines in human monocytes at both resting and lipopolysaccharide-stimulated states. Hence also used as potential candidates for novel immunomodulating therapeutics. |
| Activity Against | Human lung carcinoma A549 (IC50: 0.73 µM), Human lung carcinoma A549/paclitaxel (IC50: 1.76 µM), Escherichia coli (MIC: 3.1 µM), Escherichia coli (MIC: 16 µM), Staphylococcus aureus, Escherichia coli (MBC50: 10 µM), Escherichia coli (MBC99: 20 µM), Escherichia coli (MIC: 40 µM), Pseudomonas aeruginosa (MBC50: 0.313 µM), Pseudomonas aeruginosa (MBC99: 0.629 µM), Pseudomonas aeruginosa (MIC: 0.625 µM), Staphylococcus aureus (MBC50: 80 µM), Staphylococcus aureus (MBC99: 160 µM), Staphylococcus aureus (MIC: >160 µM), Candida albicans (MFC50: 40 µM), Candida albicans (MFC99: 160 µM), Candida albicans (MIC: >160 µM), Human histiocytic lymphoma U-937/GTB (IC50: 2.8 µM) |
| IC50 value | 0.73 µM | 1.76 µM | 2.8 µM |
| Sequence | GIPCGESCVFIPCTVTALLGCSCKDKVCYKN |
| Sequence Length | 31 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3252.9 |
| Monoisotopic Molecular Weight (Da) | 3250.5 |
| Isoelectric Point (pI) | 7.76 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P86903, G1CWH5 |
| NCBI | 347602406 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_4279, CAMPSQ6461, APD_02325, Cybase_600 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; Induces upregulation of inflammatory cytokines in THP-1 cells stimulated with LPS. (Nguyen et al., 2016) May exist as a mature linear peptide. (Serra et al., 2016) Observed PTMs: N-terminal acetylation, de-amidation N14, hexosylation S22. (Serra et al., 2016) Highly expressed in C. ternatea root and seed. (Gilding et al. 2016); Can induce chemokines such as TNF-alpha (likely Pro-inflammatory), thus playing a role in immune modulation. upDATED 4/2016. |
