PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2097	"Cyclotide cter-R, Cyclotide cliotide T7"	"23419988, 27007913, 28669767"	"Clitoria ternatea"	Fabaceae	Cyclotide	"Antibacterial, Anticancer, Antifungal"	"Target site: lipid bilayer ; Cationic cliotides display potent antibacterial activity against Gram-negative bacteria. It also possess prominent immunostimulating activity. Cationic cliotides are capable of secretion of various cytokines and chemokines in human monocytes at both resting and lipopolysaccharide-stimulated states. Hence also used as potential candidates for novel immunomodulating therapeutics."	"Human lung carcinoma A549 (IC50: 0.73 µM), Human lung carcinoma A549/paclitaxel (IC50: 1.76 µM), Escherichia coli (MIC: 3.1 µM), Escherichia coli (MIC: 16 µM), Staphylococcus aureus, Escherichia coli (MBC50: 10 µM), Escherichia coli (MBC99: 20 µM), Escherichia coli (MIC: 40 µM), Pseudomonas aeruginosa (MBC50: 0.313 µM), Pseudomonas aeruginosa (MBC99: 0.629 µM), Pseudomonas aeruginosa (MIC: 0.625 µM), Staphylococcus aureus (MBC50: 80 µM), Staphylococcus aureus (MBC99: 160 µM), Staphylococcus aureus (MIC: >160 µM), Candida albicans (MFC50: 40 µM), Candida albicans (MFC99: 160 µM), Candida albicans (MIC: >160 µM), Human histiocytic lymphoma U-937/GTB (IC50: 2.8 µM)"	GIPCGESCVFIPCTVTALLGCSCKDKVCYKN	31	"Experimental evidence at protein level"	3252.9	3250.5	7.76	--NA--	"Synthesis Type : Ribosomal; Induces upregulation of inflammatory cytokines in THP-1 cells stimulated with LPS. (Nguyen et al., 2016) May exist as a mature linear peptide. (Serra et al., 2016) Observed PTMs: N-terminal acetylation, de-amidation N14, hexosylation S22. (Serra et al., 2016) Highly expressed in C. ternatea root and seed. (Gilding et al. 2016); Can induce chemokines such as TNF-alpha (likely Pro-inflammatory), thus playing a role in immune modulation. upDATED 4/2016."