Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2090 |
| Peptide Name | NmDef02 |
| PMID(s) | 20626828 |
| Plant Source (Scientific Name) | Nicotiana megalosiphon |
| Plant Source (Common Name) | Long-flowered Tobacco |
| Plant Family | Solanaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal, Antimicrobial |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Phytophthora infestans(IC50: 1.4 µM), Phytophthora parasitica var. nicotianae(IC50: 4 µM), Alternaria solani(IC50: 2.8 µM), Fusarium oxysporum f. sp. cubense(IC50: 1 µM), Verticillium dahliae(IC50: 2 µM) |
| IC50 value | 1.4 µM | 4 µM | 2.8 µM | 1 µM | 2 µM |
| Sequence | RECKAQGRHGTCFRDANCVQVCEKQAGWSHGDCRAQFKCKCIFEC |
| Sequence Length | 45 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 5138.88 |
| Monoisotopic Molecular Weight (Da) | 5135.26 |
| Isoelectric Point (pI) | 8.51 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | C5IJZ0 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_6593, CAMPSQ2726, APD_00103 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; Transgenic plants: Constitutive expression of NmDef02 gene in transgenic tobacco and potato plants enhanced resistance against various plant microbial pathogens, including the oomycete Phytophthora infestans, causal agent of the economically important potato late blight disease, under greenhouse and field conditions. Replaced 08/2010. |
