PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2090	NmDef02	20626828	"Nicotiana megalosiphon"	Solanaceae	Defensin	"Antifungal, Antimicrobial"	"Target site- Lipid Bilayer"	"Phytophthora infestans(IC50: 1.4 µM), Phytophthora parasitica var. nicotianae(IC50: 4 µM), Alternaria solani(IC50: 2.8 µM), Fusarium oxysporum f. sp. cubense(IC50: 1 µM), Verticillium dahliae(IC50: 2 µM)"	RECKAQGRHGTCFRDANCVQVCEKQAGWSHGDCRAQFKCKCIFEC	45	"Experimental evidence at transcript level"	5138.88	5135.26	8.51	--NA--	"Synthesis Type: Ribosomal; Transgenic plants: Constitutive expression of NmDef02 gene in transgenic tobacco and potato plants enhanced resistance against various plant microbial pathogens, including the oomycete Phytophthora infestans, causal agent of the economically important potato late blight disease, under greenhouse and field conditions. Replaced 08/2010."