Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2079 |
| Peptide Name | Puroindoline-A, PINA |
| PMID(s) | 16240178 |
| Plant Source (Scientific Name) | Triticum aestivum, Aegilops tauschii x Triticum turgidum, Secale cereale, Aegilops tauschii, Aegilops tauschii var. meyeri, Aegilops ventricosa, Avena hirtula, Avena strigosa |
| Plant Source (Common Name) | Wheat, Hexaploid Wheat, Rye, Tausch's goatgrass, Oat, black Oat |
| Plant Family | Poaceae |
| Peptide Family | Puroindoline-A |
| Peptide Function | Antibacterial |
| Peptide Function Description | Target site: lipid bilayer |
| Activity Against | Escherichia coli (MIC: 30 ±0.204 µg/ml), Staphylococcus aureus (MIC: 30 ±0.408 µg/ml), Agrobacterium tumefaciens (MIC: 35 ±0.816 µg/ml), Pseudomonas syringae phaseoli (MIC: 50 ±0.689 µg/ml), Erwinia carotovora carotovora (MIC: 50 ±0.258 µg/ml), Clavibacter michiganensis (MIC: 50 ±0.491 µg/ml) |
| IC50 value | --NA-- |
| Sequence | DVAGGGGAQQCPVETKLNSCRNYLLDRCSTMKDFPVTWRWWKWWKGGCQELLGECCSRLGQMPPQCRCNIIQGSIQGDLGGIFGFQRDRASKVIQEAKNLPPRCNQGPPCNIPGTIGY |
| Sequence Length | 118 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 13092.04 |
| Monoisotopic Molecular Weight (Da) | 13083.29 |
| Isoelectric Point (pI) | 8.75 |
| Method / Extraction | --NA-- |