Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2075 |
| Peptide Name | Hispidalin |
| PMID(s) | 24834076 |
| Plant Source (Scientific Name) | Benincasa hispida |
| Plant Source (Common Name) | Wax gourd |
| Plant Family | Cucurbitaceae |
| Peptide Family | Cationic |
| Peptide Function | Antibacterial, Antifungal, Antioxidant |
| Peptide Function Description | Target site- Lipid Bilayer; Shows potent inhibitory effects against various human bacterial and fungal pathogen, i.e. it has antimicrobial and antioxidant potentials from the seeds of B. Hispida. |
| Activity Against | Escherichia coli(MIC: 100 µg/ml), Escherichia coli(MBC: 120 µg/ml), Pseudomonas aeruginosa(MIC: 120 µg/ml), Pseudomonas aeruginosa(MBC: 120 µg/ml), Bacillus cereus, Salmonella enterica(MIC: 80 µg/ml), Salmonella enterica(MBC: 100 µg/ml), Staphylococcus aureus(MIC: 100 µg/ml), Staphylococcus aureus(MBC: 120 µg/ml), Aspergillus flavus(MIC: 120 µg/ml), Aspergillus flavus(MFC: 160 µg/ml), Fusarium solani(MIC: 130 µg/ml), Fusarium solani(MFC: 180 µg/ml), Curvularia geniculata(MIC: 200 µg/ml), Curvularia geniculata(MFC: 220 µg/ml), Colletotrichum gloeosporioides, Penicillium chrysogenum(MIC: 180 µg/ml), Penicillium chrysogenum(MFC: 160 µg/ml) |
| IC50 value | --NA-- |
| Sequence | SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR |
| Sequence Length | 49 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5700.24 |
| Monoisotopic Molecular Weight (Da) | 5696.78 |
| Isoelectric Point (pI) | 8.06 |
| Method / Extraction | FPLC and HPLC |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_5427, APD_02407 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; This peptide is also antioxidant since at 40 ug/mL Hispidalin exhibited 70.8% DPPH free radical-scavenging activity and 69.5% lipid peroxide inhibition. Reg5/23/14. |
