Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_2074
Peptide Name	Mungbean Defensin PDF-1/KT46C
PMID(s)	27208129
Plant Source (Scientific Name)	Vigna radiata
Plant Source (Common Name)	Mung bean
Plant Family	Fabaceae
Peptide Family	Defensin
Peptide Function	Antibacterial, Antifungal
Peptide Function Description	Target site- Lipid Bilayer; These are identified as good candidates for development of natural additives to prevent food spoilage.
Activity Against	Lactobacillus brevis, Pediococcus dextrinicus, Staphylococcus aureus, Bacillus cereus, Salmonella typhimurium, Escherichia coli, Pseudomonas aeruginosa
IC50 value	--NA--
Sequence	KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC
Sequence Length	47
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	5503.15
Monoisotopic Molecular Weight (Da)	5499.36
Isoelectric Point (pI)	8.51
Method / Extraction	NMR

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_2074

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q8W434
NCBI	--NA--
EMBL	--NA--
Link to Source Databases	DBAASP_9711, APD_00402
Addtional Information	Synthesis Type: Ribosomal; 95% Inhibition against Lactobacillus brevis at >40 ¼g/ml; 95% Inhibition against Pediococcus dextrinicus at >40 ¼g/ml; 95% Inhibition against Staphylococcus aureus Newman at >40 ¼g/ml; 95% Inhibition against Bacillus cereus at >40 ¼g/ml; 95% Inhibition against at Salmonella typhimurium >40 ¼g/ml; 95% Inhibition against at Escherichia coli >40 ¼g/ml; 95% Inhibition against Pseudomonas aeruginosa at >40 ¼g/ml; It has an alpha-helical conformation with a hinge around Pro13.You can rotate, zoom, and view the 3D structure here in the PDB .