PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2074	"Mungbean Defensin PDF-1/KT46C"	27208129	"Vigna radiata"	Fabaceae	Defensin	"Antibacterial, Antifungal"	"Target site- Lipid Bilayer; These are identified as good candidates for development of natural additives to prevent food spoilage."	"Lactobacillus brevis, Pediococcus dextrinicus, Staphylococcus aureus, Bacillus cereus, Salmonella typhimurium, Escherichia coli, Pseudomonas aeruginosa"	KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC	47	"Experimental evidence at protein level"	5503.15	5499.36	8.51	NMR	"Synthesis Type: Ribosomal; 95% Inhibition against Lactobacillus brevis at >40 ¼g/ml; 95% Inhibition against Pediococcus dextrinicus at >40 ¼g/ml; 95% Inhibition against Staphylococcus aureus Newman at >40 ¼g/ml; 95% Inhibition against Bacillus cereus at >40 ¼g/ml; 95% Inhibition against at Salmonella typhimurium >40 ¼g/ml; 95% Inhibition against at Escherichia coli >40 ¼g/ml; 95% Inhibition against Pseudomonas aeruginosa at >40 ¼g/ml; It has an alpha-helical conformation with a hinge around Pro13.You can rotate, zoom, and view the 3D structure here in the PDB . "