Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2067 |
| Peptide Name | Defensin 4, MtDef4 |
| PMID(s) | 21533249 |
| Plant Source (Scientific Name) | Medicago truncatula |
| Plant Source (Common Name) | Barrelclover |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Fusarium graminearum (IC50: 0.75-1 µM), Fusarium graminearum (MIC: 1.5-2.5 µM) |
| IC50 value | 0.75-1 µM |
| Sequence | RTCESQSHKFKGPCASDHNCASVCQTERFSGGRCRGFRRRCFCTTHC |
| Sequence Length | 47 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5343.03 |
| Monoisotopic Molecular Weight (Da) | 5339.34 |
| Isoelectric Point (pI) | 9.17 |
| Method / Extraction | NMR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | G7L736 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_9212, APD_02428 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; In UniProt 33th amino acid is H instead of R; Active against fungus F. graminearum that causes head blight disease in cereals. MtDef4 binds to phosphatidic acid (PA). PA is a precursor for lipid biosynthesis and a signaling molecule that recruits cytosolic proteins to membranes. You can rotate, zoom, and view the NMR structure 2LR3 here in the PDB. MOA: MtDef4 rapidly permeabilizes fungal plasma membrane and is internalized by the fungal cells where it accumulates in the cytoplasm (see the structure paper PDB). THe sequence RGFRRR is likely the translolcation signal. Note that amino acid substitutions in the RGFRRR sequence not only abolished the ability of MtDef4 to enter fungal cells but also impaired its ability to bind PA. Updated 3/2015. |
