PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2067	"Defensin 4, MtDef4"	21533249	"Medicago truncatula"	Fabaceae	Defensin	Antifungal	"Target site- Lipid Bilayer"	"Fusarium graminearum (IC50: 0.75-1 µM), Fusarium graminearum (MIC: 1.5-2.5 µM)"	RTCESQSHKFKGPCASDHNCASVCQTERFSGGRCRGFRRRCFCTTHC	47	"Experimental evidence at protein level"	5343.03	5339.34	9.17	NMR	"Synthesis Type: Ribosomal; In UniProt 33th amino acid is H instead of R; Active against fungus F. graminearum that causes head blight disease in cereals. MtDef4 binds to phosphatidic acid (PA). PA is a precursor for lipid biosynthesis and a signaling molecule that recruits cytosolic proteins to membranes. You can rotate, zoom, and view the NMR structure 2LR3 here in the PDB. MOA: MtDef4 rapidly permeabilizes fungal plasma membrane and is internalized by the fungal cells where it accumulates in the cytoplasm (see the structure paper PDB). THe sequence RGFRRR is likely the translolcation signal. Note that amino acid substitutions in the RGFRRR sequence not only abolished the ability of MtDef4 to enter fungal cells but also impaired its ability to bind PA. Updated 3/2015."