Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2065 |
| Peptide Name | Nodule-specific cysteine-rich peptide 335, NCR335 |
| PMID(s) | 28167938, 25243129 |
| Plant Source (Scientific Name) | Medicago truncatula |
| Plant Source (Common Name) | Barrelclover |
| Plant Family | Fabaceae |
| Peptide Family | Nodule-specific cysteine-rich peptide |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Salmonella enterica serovar Enteritidis (MIC: 16 µM), Salmonella enterica serovar Enteritidis (MBC: 16 µM), Listeria monocytogenes (MIC: 32 µM), Listeria monocytogenes (MBC: 32 µM), Candida albicans (MIC: 11 ±1 µg/ml), Candida albicans (MFC: 8 ±2 µg/ml), Candida albicans (MIC: 12.5 ±2.5 µg/ml) |
| IC50 value | --NA-- |
| Sequence | RLNTTFRPLNFKMLRFWGQNRNIMKHRGQKVHFSLILSDCKTNKDCPKLRRANVRCRKSYCVPI |
| Sequence Length | 64 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 7736.22 |
| Monoisotopic Molecular Weight (Da) | 7731.1 |
| Isoelectric Point (pI) | 11.27 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | A7KHG5 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_10067, APD_02788 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; APD analysis reveals that the sequence of THE PEPTIDE shows 31.88% similarity to plant defensin CcD1. |
