PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2065	"Nodule-specific cysteine-rich peptide 335, NCR335"	"28167938, 25243129"	"Medicago truncatula"	Fabaceae	"Nodule-specific cysteine-rich peptide"	"Antibacterial, Antifungal"	"Target site- Lipid Bilayer"	"Salmonella enterica serovar Enteritidis (MIC: 16 µM), Salmonella enterica serovar Enteritidis (MBC: 16 µM), Listeria monocytogenes (MIC: 32 µM), Listeria monocytogenes (MBC: 32 µM), Candida albicans (MIC: 11 ±1 µg/ml), Candida albicans (MFC: 8 ±2 µg/ml), Candida albicans (MIC: 12.5 ±2.5 µg/ml)"	RLNTTFRPLNFKMLRFWGQNRNIMKHRGQKVHFSLILSDCKTNKDCPKLRRANVRCRKSYCVPI	64	"Experimental evidence at transcript level"	7736.22	7731.1	11.27	--NA--	"Synthesis Type: Ribosomal; APD analysis reveals that the sequence of THE PEPTIDE shows 31.88% similarity to plant defensin CcD1. "