Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2030 |
| Peptide Name | White cloud bean defensin |
| PMID(s) | 16687191 |
| Plant Source (Scientific Name) | Phaseolus vulgaris |
| Plant Source (Common Name) | Kidney bean |
| Plant Family | Fabaceae |
| Peptide Family | Knottin |
| Peptide Function | Antibacterial, Antiviral, Anticancer, Antifungal |
| Peptide Function Description | Target site- Lipid Bilayer |
| Activity Against | Staphylococcus aureus, Mycobacterium phlei(IC50: 86 ±6 µM), Bacillus cereus, Bacillus megaterium(IC50: 125 ±21 µM), Bacillus subtilis(IC50: 101 ±6 µM), Proteus vulgaris(IC50: 68 ±8 µM), Escherichia coli, Enterobacter aerogenes, Pseudomonas aeruginosa, Pseudomonas lachrymans, Pseudomonas fluorescens, Botrytis cinerea(IC50: 2.8 ±0.01 µM), Botrytis cinerea(IC50: 8.6 ±0.1 µM), Fusarium oxysporum(IC50: 2.3 ±0.02 µM), Fusarium oxysporum(IC50: 7.8 ±0.07 µM), Mycosphaerella arachidicola(IC50: 0.72 ±0.02 µM), Mycosphaerella arachidicola(IC50: 1.3 ±0.04 µM), Human breast adenocarcinoma MCF-7(IC50: 5.7 µM), HIV-1(IC50: 120 µM) |
| IC50 value | 86 ±6 µM | 125 ±21 µM | 101 ±6 µM | 68 ±8 µM | 2.8 ±0.01 µM | 8.6 ±0.1 µM | 2.3 ±0.02 µM | 7.8 ±0.07 µM | 0.72 ±0.02 µM | 1.3 ±0.04 µM | 5.7 µM | 120 µM |
| Sequence | MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC |
| Sequence Length | 75 |
| Validation | Protein inferred from homology |
| Average Molecular Weight (Da) | 8659.02 |
| Monoisotopic Molecular Weight (Da) | 8653.01 |
| Isoelectric Point (pI) | 7.49 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | V7BWM4 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_5850 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; In the article the sequence of (29-75)AA with S in 46 and 60th positions instead of G and R respectively, Activities are determined for isolated 7458 Da peptide, Information on DSBs is not available; Not active up to 150 µM- Staphylococcus aureus, Bacillus cereus, Escherichia coli, Enterobacter aerogenes, Pseudomonas aeruginosa, Pseudomonas lachrymans, Pseudomonas fluorescens; Inhibition of reverse transcriptase-HIV-1 |
