PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2030	"White cloud bean defensin"	16687191	"Phaseolus vulgaris"	Fabaceae	Knottin	"Antibacterial, Antiviral, Anticancer, Antifungal"	"Target site- Lipid Bilayer"	"Staphylococcus aureus, Mycobacterium phlei(IC50: 86 ±6 µM), Bacillus cereus, Bacillus megaterium(IC50: 125 ±21 µM), Bacillus subtilis(IC50: 101 ±6 µM), Proteus vulgaris(IC50: 68 ±8 µM), Escherichia coli, Enterobacter aerogenes, Pseudomonas aeruginosa, Pseudomonas lachrymans, Pseudomonas fluorescens, Botrytis cinerea(IC50: 2.8 ±0.01 µM), Botrytis cinerea(IC50: 8.6 ±0.1 µM), Fusarium oxysporum(IC50: 2.3 ±0.02 µM), Fusarium oxysporum(IC50: 7.8 ±0.07 µM), Mycosphaerella arachidicola(IC50: 0.72 ±0.02 µM), Mycosphaerella arachidicola(IC50: 1.3 ±0.04 µM), Human breast adenocarcinoma MCF-7(IC50: 5.7 µM), HIV-1(IC50: 120 µM)"	MEKKSFAGLCFLFLVLFVAQECVLQTEAKTCENLADTFRGPCFATGNCDDHCKNKEHLLRGRCRDDFRCWCTRNC	75	"Protein inferred from homology"	8659.02	8653.01	7.49	--NA--	"Synthesis Type: Ribosomal; In the article the sequence of (29-75)AA with S in 46 and 60th positions instead of G and R respectively, Activities are determined for isolated 7458 Da peptide, Information on DSBs is not available; Not active up to 150 µM- Staphylococcus aureus, Bacillus cereus, Escherichia coli, Enterobacter aerogenes, Pseudomonas aeruginosa, Pseudomonas lachrymans, Pseudomonas fluorescens; Inhibition of reverse transcriptase-HIV-1"