Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_1551 |
| Peptide Name | Brazzein |
| PMID(s) | 15118082 |
| Plant Source (Scientific Name) | Pentadiplandra brazzeana |
| Plant Source (Common Name) | --NA-- |
| Plant Family | Pentadiplandraceae |
| Peptide Family | Defensin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | --NA-- |
| Activity Against | Staphylococcus aureus, Bacillus subtilis, Escherichia coli, Candida albicans |
| IC50 value | --NA-- |
| Sequence | QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |
| Sequence Length | 54 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 6498.32 |
| Monoisotopic Molecular Weight (Da) | 6493.85 |
| Isoelectric Point (pI) | 6.71 |
| Method / Extraction | NMR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P56552 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | CAMPSQ3083, APD_01160 |
|---|
| Addtional Information | Isolated initially from a West Africa plant as a sweet protein (Ming and Hellekant 1994 FEBS Lett 355: 106-108). There are 4 S-S bonds: C4-C52, C16-C37, C22-C47, and C26-C49 (Kohmura et al. 1996 Biopolymers 38: 553-6). The protein contains one helix and 3 beta-strands (Nat Struct Biol 1998; 5: 427-31). A refined structure is also available in the PDB. Only very recently was antimicrobial property predicted based on the gamma-core motif and verified experimentally. You can rotate, zoom, and view the 3D structure here in the PDB . updated 1/16/2010; 2/2014. |
