PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1551	Brazzein	15118082	"Pentadiplandra brazzeana"	Pentadiplandraceae	Defensin	"Antibacterial, Antifungal"	--NA--	"Staphylococcus aureus, Bacillus subtilis, Escherichia coli, Candida albicans"	QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY	54	"Experimental evidence at protein level"	6498.32	6493.85	6.71	NMR	"Isolated initially from a West Africa plant as a sweet protein (Ming and Hellekant 1994 FEBS Lett 355: 106-108). There are 4 S-S bonds: C4-C52, C16-C37, C22-C47, and C26-C49 (Kohmura et al. 1996 Biopolymers 38: 553-6). The protein contains one helix and 3 beta-strands (Nat Struct Biol 1998; 5: 427-31). A refined structure is also available in the PDB. Only very recently was antimicrobial property predicted based on the gamma-core motif and verified experimentally. You can rotate, zoom, and view the 3D structure here in the PDB . updated 1/16/2010; 2/2014."