Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_1543 |
| Peptide Name | Snakin-1 |
| PMID(s) | 9885189 |
| Plant Source (Scientific Name) | Solanum tuberosum |
| Plant Source (Common Name) | Potato |
| Plant Family | Solanaceae |
| Peptide Family | Snakin |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | --NA-- |
| Activity Against | Clavibacter michiganensis subspecies sepedonicus, Pseudomonas solanAngiotensin Converting Enzymearum, Fusarium solani, Botrytis cinerea, Bipolaris maydis, Colletotrichum lagenarium |
| IC50 value | --NA-- |
| Sequence | GSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP |
| Sequence Length | 63 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 6934.09 |
| Monoisotopic Molecular Weight (Da) | 6929.13 |
| Isoelectric Point (pI) | 8.97 |
| Method / Extraction | X-ray |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | CAMPSQ2981, APD_00991 |
|---|
| Addtional Information | Active against Gram-positive (C. michiganensis) and Gram-negative (R. solanacearum) bacteria. Transgenic plants: Overexpression of snakin-1 gene enhances resistance to Rhizoctonia solani and Erwinia carotovora in transgenic potato plants (Mol Plant Pathol. 2008 May;9(3):329-38). Crystal structure has been sovled using Racemic Protein Crystallography. You can rotate, zoom, and view the 3D structure here in the PDB. There are also other structures in the PDB. The crystal structure reveals a unique protein fold with six disulfide crosslinks, presenting a distinct electrostatic surface that may target the protein to microbial cell surfaces (Yeung H et al., 2016). Updated 10/2016 GW. |
