PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1543	Snakin-1	9885189	"Solanum tuberosum"	Solanaceae	Snakin	"Antibacterial, Antifungal"	--NA--	"Clavibacter michiganensis subspecies sepedonicus, Pseudomonas solanAngiotensin Converting Enzymearum, Fusarium solani, Botrytis cinerea, Bipolaris maydis, Colletotrichum lagenarium"	GSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP	63	"Experimental evidence at protein level"	6934.09	6929.13	8.97	X-ray	"Active against Gram-positive (C. michiganensis) and Gram-negative (R. solanacearum) bacteria. Transgenic plants: Overexpression of snakin-1 gene enhances resistance to Rhizoctonia solani and Erwinia carotovora in transgenic potato plants (Mol Plant Pathol. 2008 May;9(3):329-38). Crystal structure has been sovled using Racemic Protein Crystallography. You can rotate, zoom, and view the 3D structure here in the PDB. There are also other structures in the PDB. The crystal structure reveals a unique protein fold with six disulfide crosslinks, presenting a distinct electrostatic surface that may target the protein to microbial cell surfaces (Yeung H et al., 2016). Updated 10/2016 GW. "