Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_1518
Peptide Name	Antimicrobial peptide X precursor (Sm-AMP-X)
PMID(s)	24081691
Plant Source (Scientific Name)	Stellaria media
Plant Source (Common Name)	Chickweed
Plant Family	Caryophyllaceae
Peptide Family	--NA--
Peptide Function	Antifungal
Peptide Function Description	--NA--
Activity Against	Ungerminated spores of conidia (Incubated with peptide for 24 hrs) [A. alternata (IC50 = 12.5 ±1.2 µM ), A. niger (IC50 = 4.0 ±0.6 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 16.2 ±1.8 µM ) F. oxysporum (IC50 = 5.4 ±1.0 µM ), F. solani (IC50 = 7.2 ±1.1 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )] (Incubated with peptide for 48 hrs) [A. alternata (IC50 = 14.8 ±1.5 µM ), A. niger (IC50 = 4.0 ±0.8 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 22.0 ±2.1 µM ) F. oxysporum (IC50 = 6.8 ±0.7 µM ), F. solani (IC50 = 8.0 ±0.9 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )] Germinated spores of conidia (Incubated with peptide for 24 hrs) [A. alternata (IC50 = 7.4 ±1.0 µM ), A. niger (IC50 = 2.8 ±0.8 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 9.3 ±1.0 µM ) F. oxysporum (IC50 = 8.0 ±1.2 µM ), F. solani (IC50 = 8.0 ±1.3 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )] (Incubated with peptide for 48 hrs) [A. alternata (IC50 = 8.0 ±1.1 µM ), A. niger (IC50 = 3.0 ±0.8 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 11.0 ±1.8 µM ) F. oxysporum (IC50 = 8.0 ±1.2 µM ), F. solani (IC50 = 8.0 ±1.4 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )]
IC50 value	12.5 ±1.2 µM | 4.0 ±0.6 µM | > 32.0 µM | 16.2 ±1.8 µM | 5.4 ±1.0 µM | 7.2 ±1.1 µM | > 32 µM | > 32 µM | 14.8 ±1.5 µM | 4.0 ±0.8 µM | > 32.0 µM | = 22.0 ±2.1 µM | 6.8 ±0.7 µM | 8.0 ±0.9 µM | > 32 µM | > 32 µM | 7.4 ±1.0 µM | 2.8 ±0.8 µM | > 32.0 µM | 9.3 ±1.0 µM | 8.0 ±1.2 µM | 8.0 ±1.3 µM | > 32 µM | > 32 µM | 8.0 ±1.1 µM | 3.0 ±0.8 µM | > 32.0 µM | 11.0 ±1.8 µM | 8.0 ±1.2 µM | 8.0 ±1.4 µM | > 32 µM | > 32 µM
Sequence	VDPDVRAYCKHQCMSTRGDQARKICESVCMRQD
Sequence Length	33
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	3830.38
Monoisotopic Molecular Weight (Da)	3827.72
Isoelectric Point (pI)	7.86
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_1518

External links (Uniprot, PDB and Source Information Database)
Uniprot	U4N938
NCBI	--NA--
EMBL	--NA--
Link to Source Databases	CAMPSQ8143
Addtional Information	NA