PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1518	"Antimicrobial peptide X precursor (Sm-AMP-X)"	24081691	"Stellaria media"	Caryophyllaceae	--NA--	Antifungal	--NA--	"Ungerminated spores of conidia (Incubated with peptide for 24 hrs) [A. alternata (IC50 = 12.5 ±1.2 µM ), A. niger (IC50 = 4.0 ±0.6 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 16.2 ±1.8 µM ) F. oxysporum (IC50 = 5.4 ±1.0 µM ), F. solani (IC50 = 7.2 ±1.1 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )] (Incubated with peptide for 48 hrs) [A. alternata (IC50 = 14.8 ±1.5 µM ), A. niger (IC50 = 4.0 ±0.8 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 22.0 ±2.1 µM ) F. oxysporum (IC50 = 6.8 ±0.7 µM ), F. solani (IC50 = 8.0 ±0.9 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )] Germinated spores of conidia (Incubated with peptide for 24 hrs) [A. alternata (IC50 = 7.4 ±1.0 µM ), A. niger (IC50 = 2.8 ±0.8 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 9.3 ±1.0 µM ) F. oxysporum (IC50 = 8.0 ±1.2 µM ), F. solani (IC50 = 8.0 ±1.3 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )] (Incubated with peptide for 48 hrs) [A. alternata (IC50 = 8.0 ±1.1 µM ), A. niger (IC50 = 3.0 ±0.8 µM ), B. sorokiniana (IC50 > 32.0 µM ), B. cinerea (IC50 = 11.0 ±1.8 µM ) F. oxysporum (IC50 = 8.0 ±1.2 µM ), F. solani (IC50 = 8.0 ±1.4 µM ), P. infestans (IC50 > 32 µM ), P. ultimum(IC50 > 32 µM )]"	VDPDVRAYCKHQCMSTRGDQARKICESVCMRQD	33	"Experimental evidence at protein level"	3830.38	3827.72	7.86	--NA--	NA