Detailed Peptide Information


This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking



Primary Information
PPepDB IDPPepDB_1344
Peptide Namepathogenesis-related protein 5-like
PMID(s)--NA--
Plant Source (Scientific Name)Solanum tuberosum
Plant Source (Common Name)Potato
Plant FamilySolanaceae
Peptide FamilyThaumatin
Peptide FunctionAntimicrobial
Peptide Function Description--NA--
Activity Against--NA--
IC50 value--NA--
SequenceMRISMAIISTSLMILTLLLLTFCQGILGATFTFVNQCDHTVWPGILGSPKLDSTGFELTKDTSRSFQAPTGWSGRFWGRTGCNFDDSGTGTCATADCGSGQMECNGGGAATPATLAEFTLGSGSQDFYDVSLVDGYNLPMMVEVSGGSGSCASTGCNVDLNQKCPTELRXXGGGACRSACDAFKTPQYCCEGAYASPATCSPSVYSQMFKSACPKSYSYAYDDATSTFTCSNANYIITFCLSSLTSKNSSKSDES
Sequence Length255
ValidationPredicted
Average Molecular Weight (Da)26777.33
Monoisotopic Molecular Weight (Da)26759.53
Isoelectric Point (pI)4.6
Method / Extraction--NA--


Secondary Information
Tertiary Structure and DSSP ReportClick to View Structure
Physico-Chemical Properties of peptidesClick to View Physico-Chemical Details of PPepDB_1344


External links (Uniprot, PDB and Source Information Database)
Uniprot--NA--
NCBI565347866
EMBL--NA--
Link to Source DatabasesCAMPSQ7341
Addtional InformationNA