Detailed Peptide Information


This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking



Primary Information
PPepDB IDPPepDB_1207
Peptide NameBeta purothionin
PMID(s)--NA--
Plant Source (Scientific Name)Triticum monococcum subsp. aegilopoides
Plant Source (Common Name)Einkorn Wheat
Plant FamilyPoaceae
Peptide FamilyThionin
Peptide FunctionAntimicrobial
Peptide Function Description--NA--
Activity Against--NA--
IC50 value--NA--
SequenceMGSKGLKGVMVCLLILGLVLEQVQVEGKSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGXSCPKDFPKLVLESNSDEPDTMEYCNLGCRSSLCDYMVNAAADDEEMKLYVEQCGDACVNFCNVDAGLTSLDA
Sequence Length136
ValidationPredicted
Average Molecular Weight (Da)14669.19
Monoisotopic Molecular Weight (Da)14659.03
Isoelectric Point (pI)4.94
Method / Extraction--NA--


Secondary Information
Tertiary Structure and DSSP ReportClick to View Structure
Physico-Chemical Properties of peptidesClick to View Physico-Chemical Details of PPepDB_1207


External links (Uniprot, PDB and Source Information Database)
UniprotB8YLY9
NCBI218766970
EMBL--NA--
Link to Source DatabasesCAMPSQ5260
Addtional InformationNA