Detailed Peptide Information


This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking



Primary Information
PPepDB IDPPepDB_817
Peptide NameZeamatin-like protein
PMID(s)--NA--
Plant Source (Scientific Name)Zea mays subsp. Parviglumis
Plant Source (Common Name)Maize
Plant FamilyPoaceae
Peptide FamilyThaumatin
Peptide FunctionAntimicrobial
Peptide Function Description--NA--
Activity Against--NA--
IC50 value--NA--
SequenceMAGSVAIVGIFVALLAVAGEAAVFTVVNQCPFTVWAASVPVGGGRQLNRGESWRITAPAGTTAARIWARTGCKFDASGRGSCRTGDCGGVLQCTGYGRAPNTLAEYALKQFNNLDFFDISLIDGFNVPMSFLPDGGSGCSRGPRCAVDVNARCPAELRQDGVCNNACPVFKKDEYCCVGSAANDCHPTNYSRYFRACSVAPIPXXIGLTEQALKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP
Sequence Length246
ValidationPredicted
Average Molecular Weight (Da)25942.85
Monoisotopic Molecular Weight (Da)25925.8
Isoelectric Point (pI)7.82
Method / Extraction--NA--


Secondary Information
Tertiary Structure and DSSP ReportClick to View Structure
Physico-Chemical Properties of peptidesClick to View Physico-Chemical Details of PPepDB_817


External links (Uniprot, PDB and Source Information Database)
UniprotB8QY03
NCBI214016748
EMBL--NA--
Link to Source DatabasesCAMPSQ5231
Addtional InformationNA