Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_6113 |
| Peptide Name | ASAL_ALLSA |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Allium sativum |
| Plant Source (Common Name) | Garlic |
| Plant Family | Amaryllidaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Alternative splicing; Direct protein sequencing; Lectin; Mannose-binding; Plant defense; Secreted; Signal | Mannose-specific lectin precursor (Leaf agglutinin) (Root agglutinin),(Allimin) (ASAL) (ASARI).Secreted (By similarity). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | MGRTTSSPKAMMRIATVAAILTILASTCMARNVLTNGEGLYAGQSLDVEQNGTVDGGSVIGPVVVNQNVTAAIRKVGTGAARPVWASNSVRGNGNYILVLQKDRNVVIYGSDIWSTGTYRRSVGGAVVMAMYKFIMQDDCNLVLYEYSTPIWASNTGVTGKNGCRAVMQRDGNFVVYDVNG |
| Sequence Length | 181 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 19282.04 |
| Monoisotopic Molecular Weight (Da) | 19269.67 |
| Isoelectric Point (pI) | 9.27 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P83886 |
| NCBI | --NA-- |
| EMBL | U58947 |
| Link to Source Databases | SPdb16561 |
|---|
| Addtional Information | FUNCTION:Mannose-specific lectin. Shows agglutinating activity towards rabbit erythrocytes, but not human erythrocytes. Has insecticidal activity against the cotton leafworm S.littoralis and the peach potato aphid M.persicae.SUBUNIT:Homodimer.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P83886-1; Sequence=Displayed; Name=2; IsoId=P83886-2; Sequence=VSP_030211, VSP_030212;MASS SPECTROMETRY:Mass=12382; Method=MALDI; Range=31-181; Note=Leaf agglutinin; Source=PubMed:9037141;MASS SPECTROMETRY:Mass=15682; Method=MALDI; Range=31-181; Note=Root agglutinin; Source=PubMed:9037141;MISCELLANEOUS:Controls hyperglycemia in diabetic mice. Also shows some insulin mimetic effects in vitro, including activation of tyrosine kinase, PI3 kinase and stimulation of nitric oxide synthesis.SIMILARITY:Contains 1 bulb-type lectin domain. |
